General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W9K3W7",
        "id": "W9K3W7_FUSOX",
        "source_organism": {
            "taxId": "660027",
            "scientificName": "Fusarium oxysporum Fo47",
            "fullName": "Fusarium oxysporum Fo47"
        },
        "name": "Uncharacterized protein",
        "description": [
            "Histones H3 and H4 chaperone involved in the nucleosome formation and heterochromatin silencing. Required for the deposition of H3K56ac-carrying H3-H4 complex onto newly-replicated DNA. Plays a role in the transcriptional regulation of the cell-cycle dependent histone genes by creating a repressive structure at the core histone gene promoter"
        ],
        "length": 517,
        "sequence": "MGKTLDTEKLGSVFGTRPDILEGIQRAADTPGRIALFNEIATHVYDQLLNGGNEPAHKKRRVDVQTNGAANGTKPVKTETNAADEAVLLEIKEISVSVPQRKKFELCFTDGHIYARAPNTAAPIPAITYAWSDIEYVFYLPVPEKNQVQHNYVIFPRGTCLPSKTNPPAEEPLVFTVPATAPKQGTIGGPDAGSAAAVSDNYKSLFHWALNRHLKPNGVSIISADPNKFQSMVRQPHRPSEKAVHVKAFRGSKDGYLFFLENGILWGFKKPMMFIPLSRIAATSYTNILQRTFNIAIEVFAGEGDATEEAEFSMLDQEDYSGIDDYIKTHRLQDRSMAEQRKAKLELAENRGSKKNGEEAGDDAPAEAGISELAKAQLDAEQALQDEEDEDEEDYDPGSDADSDGSGESDDDDDSDDDDEDEEDEEDAEGEAEDGDEQAEGDEEEEEEQEEVKQEPEPVKRSRKAATPPAEPVPPSKPAKQPVQQPVVKTGWAALRSVPRAPVPESMDLDEEKFDVV",
        "proteome": null,
        "gene": "FOZG_10623",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2a46699110152ad722393483de7cf196038e7f08",
        "counters": {
            "domain_architectures": 1518,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1518
        }
    }
}