General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W8TWD5",
        "id": "W8TWD5_STAAU",
        "source_organism": {
            "taxId": "1280",
            "scientificName": "Staphylococcus aureus",
            "fullName": "Staphylococcus aureus"
        },
        "name": "Branched-chain amino acid transport system carrier protein",
        "description": [
            "Component of the transport system for branched-chain amino acids (leucine, isoleucine and valine), which is coupled to a proton motive force. Contributes to NaCl tolerance"
        ],
        "length": 447,
        "sequence": "MNKNTWVIGFTLFAMFFGAGNLIFPPNLGLDSGQFFWPAILAFVLTGIGLPLLGVIVGALDKEGYIGALNKISPKFSILFLIIIYLTIGPLFAIPRTASTSFEMTITPIIHSNSSIALFIFTIIYFIVVLYICLNPSKLIDRIGSLLTPLLLITILAMIIKGYLDFSGNSAGKGNEALYHSNFSSFAEGFTQGYLTMDAIAAIAFSMIVVNAVKLTGITKTNQIFKQTLTAGLIAAVALIFIYISLGYIGNHMPVSDMTLDQLKSKDRNIGTYLLTTMASTGFGSFGKYLLGIIVALACLTTACGLIVAVSEYFHRIVPKVSYKAFVLVFILMSFIIANQGLNAVISMSIPVLSIVYPVAITVVLLILIAKFIPTKRISQQIPVIIVFILSIFSVISKLGWLKINFIESLPLRAYSLEWFPVAIIATILGYLVGIFVKQDPIKYQQE",
        "proteome": null,
        "gene": "brnQ",
        "go_terms": [
            {
                "identifier": "GO:0015658",
                "name": "branched-chain amino acid transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015803",
                "name": "branched-chain amino acid transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "446dc9218da3cbb41f320dbd1853421b3ada73a1",
        "counters": {
            "domain_architectures": 12592,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 12592
        }
    }
}