GET /api/protein/UniProt/W8R479/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W8R479",
        "id": "W8R479_9NIDO",
        "source_organism": {
            "taxId": "1465644",
            "scientificName": "Deltacoronavirus PDCoV/USA/Illinois121/2014",
            "fullName": "Deltacoronavirus PDCoV/USA/Illinois121/2014"
        },
        "name": "Membrane protein",
        "description": [
            "Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins"
        ],
        "length": 217,
        "sequence": "MSDAEEWQIIVFIAIIWALGVILQGGYATRNRVIYVIKLILLWLLQPFTLVVTIWTAVDRSSKKDAVFIVSIIFAVLTFISWAKYWYDSIRLLMKTRSAWALSPESRLLAGIMDPMGTWRCIPIDHMAPILTPVVKHGKLKLHGQELANGISVRNPPQDMVIVSPSDTFHYTFKKPVESNNDPEFAVLIYQGDRASNAGLHTITTSKAGDARLYKYM",
        "proteome": null,
        "gene": "M",
        "go_terms": [
            {
                "identifier": "GO:0039660",
                "name": "structural constituent of virion",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055036",
                "name": "virion membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "91c5beb36026ee833bea286181574b66d2e76e24",
        "counters": {
            "domain_architectures": 2961,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2961
        }
    }
}