GET /api/protein/UniProt/W8R479/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "W8R479",
"id": "W8R479_9NIDO",
"source_organism": {
"taxId": "1465644",
"scientificName": "Deltacoronavirus PDCoV/USA/Illinois121/2014",
"fullName": "Deltacoronavirus PDCoV/USA/Illinois121/2014"
},
"name": "Membrane protein",
"description": [
"Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins"
],
"length": 217,
"sequence": "MSDAEEWQIIVFIAIIWALGVILQGGYATRNRVIYVIKLILLWLLQPFTLVVTIWTAVDRSSKKDAVFIVSIIFAVLTFISWAKYWYDSIRLLMKTRSAWALSPESRLLAGIMDPMGTWRCIPIDHMAPILTPVVKHGKLKLHGQELANGISVRNPPQDMVIVSPSDTFHYTFKKPVESNNDPEFAVLIYQGDRASNAGLHTITTSKAGDARLYKYM",
"proteome": null,
"gene": "M",
"go_terms": [
{
"identifier": "GO:0039660",
"name": "structural constituent of virion",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0055036",
"name": "virion membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "91c5beb36026ee833bea286181574b66d2e76e24",
"counters": {
"domain_architectures": 2961,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"profile": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2961
}
}
}