General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W8KDR1",
        "id": "W8KDR1_9GAMM",
        "source_organism": {
            "taxId": "421628",
            "scientificName": "Ectothiorhodospira haloalkaliphila",
            "fullName": "Ectothiorhodospira haloalkaliphila"
        },
        "name": "Diaminopimelate epimerase",
        "description": [
            "Catalyzes the stereoinversion of LL-2,6-diaminopimelate (L,L-DAP) to meso-diaminopimelate (meso-DAP), a precursor of L-lysine and an essential component of the bacterial peptidoglycan"
        ],
        "length": 278,
        "sequence": "MTLSFTKMQGLGNDFVVIDGVRQAIELTPERVRFLAHRRLGVGCDQVLLVEPPADPARAAFRYRIFNADGGEVEQCGNGARCFAVFVRDQGLTDQTLIPVETAGGLIRLQVEDNGQVTVNMGRPRFEPAEIPFEAPAVAPSYPLEVGGGSVEIGAVSMGNPHAVVRVEDVLKAPVESLGPIIESHPRFPRRVNAGFMEVLARDHVRLRVFERGAGETQACGTGACAAVVSGRTRGWLDERVAVDLPGGRLVIQWQGCEDAPVFMTGPATSVFTGNIKL",
        "proteome": "UP000019442",
        "gene": "dapF",
        "go_terms": [
            {
                "identifier": "GO:0008837",
                "name": "diaminopimelate epimerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009089",
                "name": "L-lysine biosynthetic process via diaminopimelate",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3f6029b627c8103bc70988b03974bbb9f9795c3e",
        "counters": {
            "domain_architectures": 24564,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 24564
        }
    }
}