General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W8CGI2",
        "id": "W8CGI2_9PASS",
        "source_organism": {
            "taxId": "555261",
            "scientificName": "Gubernatrix cristata",
            "fullName": "Gubernatrix cristata"
        },
        "name": "V(D)J recombination-activating protein 1",
        "description": [
            "Catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T-lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. RAG2 is not a catalytic component but is required for all known catalytic activities. DNA cleavage occurs in 2 steps: a first nick is introduced in the top strand immediately upstream of the heptamer, generating a 3'-hydroxyl group that can attack the phosphodiester bond on the opposite strand in a direct transesterification reaction, thereby creating 4 DNA ends: 2 hairpin coding ends and 2 blunt, 5'-phosphorylated ends"
        ],
        "length": 961,
        "sequence": "KLRSIEKTASDDSQHIHKDQAEEAVSSNKEIILHEDEAMSRGEKMELMGNRQGLEEDAHAMKTQDNRVHQNNLKKLCRICGVSFKTDCSKRTYPVHGPVDDETLRLLRKKEKTATSWPDLIAKVFKIDVRGDVDTIHPTQFCHNCWSIIHRKFSNTLCEVYFPRNSTMEWQPHSPNCDVCHTTRPGVKRKSQPPSVXRGKRVKTTGERVQLNRGVKNQHLKQAQINNKNLMKEIVNCKDIHLSTKLLVVDYPVDFIKSISCQICDHILADPVETTCRHLFCRTCILKCIRVMGSYCPSCWYPCFPTDLVTPVKTFLNILDNLXIRCPVKECDEEISHGKYGQHLSGHKEMKEGELYSYINKGGRPRQHLLSLTRRAQKHRLRELKXQVKAFAEKEEGGDIKAVCMTLFLLALRAKNEHKQADELEAIMQGRGSGLHPAVCLAIRINTFLSCSQYHKMYRTVKAVTGRQIFQPLHALRTAEKALLPGYHPFEWKPPLKNVSTNTEVGIIDGLSGLPLSIDDYPVDTIAKRFRYDAALVCALKDMEEEILEGMKAKNLDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTVMNISIAHGNESKRIFEEVKPNSELCCKPLCLMLADESDHETLTAILSPLIAEXEAMKNSELLLEMGGILRTFRFVFRGTGYDEKLLREVEGLEASGSTYICTLCDATRQEASQNLVFHSITRSHAENLERYEIWRSNPYHESVDELRDRVKGVSAKPFIETVPSIDALHCDIGNATEFYRIFQMEIGELYKNPDVSKEERKRWQLTLDKHLRKKMNLKPMLKMSGNFARKLMSKETVEAVCELIKCEERHEALKELMDLYLKMKPVWRSSCPAKECPELLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKVYEMEDVL",
        "proteome": null,
        "gene": "RAG-1",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004519",
                "name": "endonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0061630",
                "name": "ubiquitin protein ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0033151",
                "name": "V(D)J recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "6ee2450311170dd9e1c253053c6453a9993f02cd",
        "counters": {
            "domain_architectures": 2309,
            "entries": 38,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 3,
                "cdd": 1,
                "profile": 3,
                "pfam": 10,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 16
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2309
        }
    }
}