GET /api/protein/UniProt/W8CCX1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W8CCX1",
        "id": "W8CCX1_CERCA",
        "source_organism": {
            "taxId": "7213",
            "scientificName": "Ceratitis capitata",
            "fullName": "Ceratitis capitata (Mediterranean fruit fly)"
        },
        "name": "Deoxyhypusine hydroxylase",
        "description": [
            "Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor"
        ],
        "length": 300,
        "sequence": "MVTQEQVKSIGAVLNNKERPLKERFRALFTLKNLGGADAIEEISRGFTDDSALLKHELAYCLGQMQDKKAIKILTNVLADAGQEPMVRHEAGEALGAIGDPEVIPILEKFKGDSVIEVAETCTIALERVHWLQSGQKVDDNNPYASVDPSPPAPGNKNVDDLKAIYLDVNQSLFERYRAMFSLRNLRTTESILAIAEGLRDPSALFRHEVAFVLGQIQEPCSIPYLRHNLEDGNENEMVRHECAEALGAIATEECINILGRYADDEKRVVKESCEIALDMCEYENSPEFQYADSLNKLST",
        "proteome": null,
        "gene": "DOHH",
        "go_terms": [
            {
                "identifier": "GO:0019135",
                "name": "deoxyhypusine monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008612",
                "name": "peptidyl-lysine modification to peptidyl-hypusine",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "04f07e6051b80d005d76fec2e7df18f06a33a199",
        "counters": {
            "domain_architectures": 6595,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6595
        }
    }
}