HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "W7M7S1",
"id": "W7M7S1_GIBM7",
"source_organism": {
"taxId": "334819",
"scientificName": "Gibberella moniliformis (strain M3125 / FGSC 7600)",
"fullName": "Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus)"
},
"name": "Eukaryotic translation initiation factor 5A",
"description": [
"Translation factor that promotes translation elongation and termination, particularly upon ribosome stalling at specific amino acid sequence contexts. Binds between the exit (E) and peptidyl (P) site of the ribosome and promotes rescue of stalled ribosome: specifically required for efficient translation of polyproline-containing peptides as well as other motifs that stall the ribosome. Acts as ribosome quality control (RQC) cofactor by joining the RQC complex to facilitate peptidyl transfer during CAT tailing step"
],
"length": 164,
"sequence": "MAAPNDAEHEMTFDSADAGASLTYPMQCSALRKNGFVVIKNRPCKIVDMSTSKTGKHGHAKVHLVATDIFTGKKYEDLSPSTHNMDVPNVSRREYQLLDISDDGFLSLMTDDGDTKDDVPLPDNEVGQKITKLFKEEEKDTNVIVLTSMGEECAMEAKEAPNQG",
"proteome": "UP000009096",
"gene": "FVEG_07289",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043022",
"name": "ribosome binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003746",
"name": "translation elongation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006414",
"name": "translational elongation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "49588e12a4e3bbab755a318a8c0a4b092e3727b0",
"counters": {
"domain_architectures": 7475,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"smart": 1,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7475
}
}
}