HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "W7LLG2",
"id": "W7LLG2_CYTFI",
"source_organism": {
"taxId": "1307436",
"scientificName": "Cytobacillus firmus DS1",
"fullName": "Cytobacillus firmus DS1"
},
"name": "Kynureninase",
"description": [
"Catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively"
],
"length": 422,
"sequence": "MDFTKEYAIGLDAGNGLSCREEFYIKEDGIYLDGNSLGLLSKRAEKSLLDLLESWKHHAIDGWTEGDNPWFYLSEKLGKEMAPIVGANPEEVIVSGSTTVNLHQLVSTFYKPEGKRTKILADELNFPSDIYALQSQVKLKGYDPEEHLVQVKSADGHTLREEDIVAAMTDEIALIVLPGVLYRSGQVLDMEYLTAEAHKRGIEIGFDLCHSVGSVPHALSDWDVDFAFWCNYKHLNGGPGSTGGLFVNKRHFGQVPGLAGWFSSRKDKQFDMEHVLTAAEDAGAYQIGTPNIFSMAPIIGSLSMFNEIGIERIREKSLQLTGYMIELIQHELDGHGLVLRNPLDEKKRGGHIYLEHPEAARICKALKAEGVIPDFRAPNGIRLAPVALYNTFEDVWKTVQILKGIMEEEKYKQFENKRGVVA",
"proteome": null,
"gene": "kynU",
"go_terms": [
{
"identifier": "GO:0030170",
"name": "pyridoxal phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030429",
"name": "kynureninase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006569",
"name": "L-tryptophan catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009435",
"name": "NAD+ biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "39901a599ed8bfa04284073fd8aaddba19cf5b1f",
"counters": {
"domain_architectures": 10656,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 1,
"hamap": 1,
"pirsf": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 10656
}
}
}