General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W7JV52",
        "id": "W7JV52_PLAFA",
        "source_organism": {
            "taxId": "1237627",
            "scientificName": "Plasmodium falciparum UGT5.1",
            "fullName": "Plasmodium falciparum UGT5.1"
        },
        "name": "18S rRNA aminocarboxypropyltransferase",
        "description": [
            "Aminocarboxypropyltransferase that catalyzes the aminocarboxypropyl transfer on pseudouridine in 18S rRNA. It constitutes the last step in biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypropyl) pseudouridine (m1acp3-Psi)"
        ],
        "length": 318,
        "sequence": "MNKIKMKNNYIERKKYSIHNLVKLINEKKNIENSKKNELSEGTTEKKNVSIENNDVHMNSKKKKKKNRTDKENGHIKNEDFINSSSNDENDCTNNEENIVNDDQEELTDDKNKLCYDHEIINNGSSDDNEIKLFMFDYKECQNKKCSCKKLYRFKKIKKVQMNKKFKGIVLTPFCEKYFSIDDKYTIENYGLSVVDCSWKSIDLLKRIKFSNQRKLPYIIAVNSINYGKPYKLSCLESLAFCLYVCNYNKQCNDILNIYKWSVNFTNLNKELLDTYKLCNTHDEIKNAEEEFIQKYLHEKEQNKKIDEYKIIYEDDYI",
        "proteome": null,
        "gene": "C923_03922",
        "go_terms": [
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0106388",
                "name": "rRNA small subunit aminocarboxypropyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006364",
                "name": "rRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "65ff0203bf4742068491905f5078a19c9c4e96f0",
        "counters": {
            "domain_architectures": 571,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 571
        }
    }
}