General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W6ZUP7",
        "id": "W6ZUP7_COCMI",
        "source_organism": {
            "taxId": "930090",
            "scientificName": "Bipolaris oryzae ATCC 44560",
            "fullName": "Bipolaris oryzae ATCC 44560"
        },
        "name": "Biogenesis of lysosome-related organelles complex 1 subunit KXD1",
        "description": [
            "Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) involved in endosomal cargo sorting"
        ],
        "length": 188,
        "sequence": "MASSHSFYNLPQASYPINMPQKPGFFFPAQQHGYGRVSGSPPEAPNSVTTSGVPSYEPSSTSSNYAGSASDYESTSGAASVDLLDYMGRRVNGSFDPMPLDRSLAKQAQTSGELNAKQRELSELQALAQRRLAGARMSFADGMKAAKDVQKDLQWTQKRVDSLNNRAARKYPEQFRTAQSRYPAPVDF",
        "proteome": "UP000054032",
        "gene": "COCMIDRAFT_86",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "32363ec8dc9a2e5d3bd7c5759ae7b53c00abf604",
        "counters": {
            "domain_architectures": 3383,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3383
        }
    }
}