HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "W6R2U3",
"id": "W6R2U3_ECTO5",
"source_organism": {
"taxId": "1182590",
"scientificName": "Ectopseudomonas oleovorans (strain CECT 5344)",
"fullName": "Ectopseudomonas oleovorans (strain CECT 5344)"
},
"name": "HTH-type transcriptional regulator MerD",
"description": null,
"length": 121,
"sequence": "MSAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTPGGYGLFDDAALQRLCFVRAAFEAGIGLDALARLCRALDAADGDEAAAQLAVLRQFVERRREALADLEVQLATMPTEPAQHAESLP",
"proteome": null,
"gene": "merD",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045892",
"name": "negative regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046689",
"name": "response to mercury ion",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c4db4cb6ae5d1724276ba6e39169f8f8c6eb51d3",
"counters": {
"domain_architectures": 113891,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"ssf": 1,
"cdd": 1,
"ncbifam": 2,
"panther": 1,
"pfam": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 113891
}
}
}