GET /api/protein/UniProt/W6QXE6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W6QXE6",
        "id": "W6QXE6_ECTO5",
        "source_organism": {
            "taxId": "1182590",
            "scientificName": "Ectopseudomonas oleovorans (strain CECT 5344)",
            "fullName": "Ectopseudomonas oleovorans (strain CECT 5344)"
        },
        "name": "GTP 3',8-cyclase",
        "description": [
            "Catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate"
        ],
        "length": 331,
        "sequence": "MNTHQLVDPFGRRITYLRLSVTDRCDFRCTYCMSEDMQFAPRAQILSLEELYAVADAFIGLGVRRIRITGGEPLVRKNLLSLLQRLGERDELDDLAITTNGSQLAEMAAPLRAAGVRRLNISLDSLQRERFAAFTRRDKLDQVLAGIDAARAAGFDRIKLNSVVQSGRNDDEVLDLVEFAIERGLDISFIEEMPLGSVVSHSREQTFCSSDEVRQRIEQRHALVRSSKVTGGPSRYWQVLGTQTQVGFISPHSHNFCGDCNRVRVTAEGKLVLCLGHDNALDLKRVLRAHPGDGERLRQALIEALRLKPERHHFATDEQVQVVRFMSMTGG",
        "proteome": null,
        "gene": "moaA3",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006777",
                "name": "Mo-molybdopterin cofactor biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9bae3ee1a5f3142cd02f57372aa2ae7310271f8b",
        "counters": {
            "domain_architectures": 24800,
            "entries": 25,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "cdd": 2,
                "pfam": 2,
                "panther": 1,
                "sfld": 4,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 24800
        }
    }
}