General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W6PV36",
        "id": "W6PV36_PENRF",
        "source_organism": {
            "taxId": "1365484",
            "scientificName": "Penicillium roqueforti (strain FM164)",
            "fullName": "Penicillium roqueforti (strain FM164)"
        },
        "name": "25S rRNA adenine-N(1) methyltransferase",
        "description": [
            "S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the N(1) position of an adenine present in helix 65 in 25S rRNA"
        ],
        "length": 283,
        "sequence": "MAPQKRSKRPLLLSHSRPRIVKSKDAALSAKATRTLIRSHHRLLKVRAQALAAGDEARVSSIDAQIQANGGLESYQIASKLGQSMDRGGDSSKVLIDWIKPQLKQWNKDIPKLRVLEVGALSTKNACSTNPALDVTRIDLNSQEPGILKQDFMERPLPSSDDERFDMISLSLVLNYVPDATGRGEMLKRCVKFLTSKCPIELVPSLFLVLPIACVDNSRYLNEGRLGEIMACLGFRLTQSKRTSKLVFHLWEHTGTYSPKAFKKEELRSGKTRNNFAVILNKK",
        "proteome": "UP000030686",
        "gene": "PROQFM164_S01g001914",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b4004ad669ddcff91933f785af02ff8b8433ab50",
        "counters": {
            "domain_architectures": 2617,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2617
        }
    }
}