General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W6PU18",
        "id": "W6PU18_9BACE",
        "source_organism": {
            "taxId": "702447",
            "scientificName": "Bacteroides xylanisolvens SD CC 1b",
            "fullName": "Bacteroides xylanisolvens SD CC 1b"
        },
        "name": "Redox-sensing transcriptional repressor Rex",
        "description": [
            "Modulates transcription in response to changes in cellular NADH/NAD(+) redox state"
        ],
        "length": 216,
        "sequence": "MSTSIRKEADKVPEPTLRRLPWYLSNIKLMKEKGEQYVSSTQISKEINIDASQIAKDLSYVNISGRTRVGYNIDALIEVLESFLGFTNMHKAFLFGVGSLGAALLRDSGLHHFGLEIVAAFDVNPELVGKDLNGIPIFHSDDFEAKMKEYDVNIGVLTVPINIAQEITDKMVDGGIKAVWNFTPFRIRVPENIVVQNTSLYAHLAVMFNRLNFNEK",
        "proteome": null,
        "gene": "rex",
        "go_terms": [
            {
                "identifier": "GO:0045892",
                "name": "negative regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0051775",
                "name": "response to redox state",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "db99d62d5d52eccebee351ffcd8f5b0462807149",
        "counters": {
            "domain_architectures": 8959,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "smart": 1,
                "pfam": 2,
                "hamap": 1,
                "ncbifam": 3,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8959
        }
    }
}