GET /api/protein/UniProt/W5SU33/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "W5SU33",
"id": "W5SU33_9SPIR",
"source_organism": {
"taxId": "1408429",
"scientificName": "Borrelia coriaceae ATCC 43381",
"fullName": "Borrelia coriaceae ATCC 43381"
},
"name": "Triosephosphate isomerase",
"description": [
"Involved in the gluconeogenesis. Catalyzes stereospecifically the conversion of dihydroxyacetone phosphate (DHAP) to D-glyceraldehyde-3-phosphate (G3P)"
],
"length": 254,
"sequence": "MRKIFLAGNWKMHYTGVEAAGIAKQIVDGVKYIKDDVVVMLTPAFTSLYKVCEVTRGSNVLLGAQNMSYEESGARTSEIAPSMLLEFGVDYVILGHSECRTYLGDTDEVVNKKILSGLKHPFKYLILCIGETLDERENNRTLDVVLNQIRRGLSSVSESDLKRIILAYEPVWAIGTGRTATKEEAQEVHKAIRLEIESLYSKSAADNIVIQYGGSVNIDNVEDLLGENDIDGALIGGASLKADSFLKIVSKVAK",
"proteome": "UP000019330",
"gene": "tpiA",
"go_terms": [
{
"identifier": "GO:0004807",
"name": "triose-phosphate isomerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006096",
"name": "glycolytic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c3c3e169e7801783a548872d8a2d4b37a5ecd302",
"counters": {
"domain_architectures": 42874,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 42874
}
}
}