General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W5NII0",
        "id": "W5NII0_LEPOC",
        "source_organism": {
            "taxId": "7918",
            "scientificName": "Lepisosteus oculatus",
            "fullName": "Lepisosteus oculatus (Spotted gar)"
        },
        "name": "Pleiotrophin",
        "description": [
            "Secreted growth factor that mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors. Regulates many processes like cell proliferation, cell survival, cell growth, cell differentiation and cell migration"
        ],
        "length": 183,
        "sequence": "MNMTCILDALFDHKKHTSSERMQNHQQWMIGALVVALLVLTAMAGDIGKAEKQGKKERKSDCGEWQWSVCVANVGDCGLGTREGTRTGNDCKQTIKTQKCKIPCNWKKQFGGECKYDFQAWGDCDMSTGKKNRTGVLKRALPDATCPDTVSATKPCGKIVKTKLQDSKKPKREGKKKERTPMD",
        "proteome": "UP000018468",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0008083",
                "name": "growth factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "73d3c0a451752511ddb54ca2fe71979430ffbaed",
        "counters": {
            "domain_architectures": 2164,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 1,
                "smart": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2164
        }
    }
}