General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W5N331",
        "id": "W5N331_LEPOC",
        "source_organism": {
            "taxId": "7918",
            "scientificName": "Lepisosteus oculatus",
            "fullName": "Lepisosteus oculatus (Spotted gar)"
        },
        "name": "Threonyl/alanyl tRNA synthetase SAD domain-containing protein",
        "description": [
            "Functions in trans to edit the amino acid moiety from incorrectly charged tRNA(Ala)"
        ],
        "length": 412,
        "sequence": "MAFQCQRDCYLQEFTTTVVSCRPAELKLDNSGKKETVKGFNVTLEDTVLFPEGGGQPDDRGLIGGVPVLRVTRQGAEAVHFVAAPLEEGSSVRLKLDWDRRFDHMQQHSGQHLITAIADSMFGYKTTSWELGRQRSVIELDTAAMKPGEAQALEKAVNEKIRACVPVTVQLLSPDDPAVEKVRSRGLPEDHAGPVRIIDIEGIDANMCCGTHVSNLSHLQVIKILGTEKGKKNKTNVIFLAGDRVLKYADRSYNTERALTSLLKTGAEEHVEAVDKLQKSVKLLQKNNLNLLRDLAVLTAQNFKSNPNRGKLFCLHRKDGDNEFMNIIANEIGTEDTLLFLTVGEEKGAGLFLLAGPAETVDSLGPRVAETLDGKGAGKRGRYQGKASRMAQRGEAELLLLEYLKHCSSEEE",
        "proteome": "UP000018468",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004812",
                "name": "aminoacyl-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043039",
                "name": "tRNA aminoacylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "78120bc82faf08c7b575a4e8c04d4eed961f57ca",
        "counters": {
            "domain_architectures": 5767,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5767
        }
    }
}