GET /api/protein/UniProt/W5MUD1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W5MUD1",
        "id": "W5MUD1_LEPOC",
        "source_organism": {
            "taxId": "7918",
            "scientificName": "Lepisosteus oculatus",
            "fullName": "Lepisosteus oculatus (Spotted gar)"
        },
        "name": "Myeloid differentiation primary response protein MyD88",
        "description": [
            "Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response"
        ],
        "length": 286,
        "sequence": "ANMSETDSYGIPLTALNVTVRKKLSLYLNPKTTVAADWTTLAETMGFDYLEIKNFDQYQDPTKKILDEWMSRCPEATVGKLIQMLNEAGREDVITDLKPIIDKDCKDYLRKKQMKEPPVQVPEVTSCGPRTQEINGITVLDDPMGHMPEMFDAFICYCQNDIEFVHEMIRQLEQTEYKLKLCVFDRDVLPGTCVWTITSELIEKRCKRMVVVISDDYLDSECCDFQTKFALSLSPGARSKRLIPVVYKTMKKQFPSILRFLTLCDYTKPCTKSWFWIRLAKALALP",
        "proteome": "UP000018468",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007165",
                "name": "signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0070976",
                "name": "TIR domain binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0002755",
                "name": "MyD88-dependent toll-like receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043123",
                "name": "positive regulation of canonical NF-kappaB signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e1dfea92889ab4967c54a36bc5dbff4910fc15fa",
        "counters": {
            "domain_architectures": 1089,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "smart": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 2,
                "profile": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1089
        }
    }
}