General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W2SLK5",
        "id": "W2SLK5_NECAM",
        "source_organism": {
            "taxId": "51031",
            "scientificName": "Necator americanus",
            "fullName": "Necator americanus (Human hookworm)"
        },
        "name": "Repressor of RNA polymerase III transcription MAF1",
        "description": [
            "Element of the TORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA"
        ],
        "length": 240,
        "sequence": "MKYLENSSLEALSSSLSIGAIDCILDVKLESYSCKMVQSDKKQWKAYGGSNESSNVNDRQPLSPPDDFLSVSASPIGHSARMRHLSEAGHSGSETDADDFVLLDSISKRTLFDLIGALNIAYPDYDFSDVKSNCFSLIPGIEVVMEAVDSKFYATVNSYTSMRDELWLAIDNEIKPNECRIYSFKTNYKDDPFSEDGCLWCLNFFFHNKSLKRLMLLSCRALSQNGVTAYGDSLWDLDED",
        "proteome": "UP000053676",
        "gene": "NECAME_05199",
        "go_terms": [
            {
                "identifier": "GO:0016480",
                "name": "negative regulation of transcription by RNA polymerase III",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba6bf6bac6beb12115815454bc348b426cd3435a",
        "counters": {
            "domain_architectures": 4252,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4252
        }
    }
}