GET /api/protein/UniProt/W2SLK5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "W2SLK5",
"id": "W2SLK5_NECAM",
"source_organism": {
"taxId": "51031",
"scientificName": "Necator americanus",
"fullName": "Necator americanus (Human hookworm)"
},
"name": "Repressor of RNA polymerase III transcription MAF1",
"description": [
"Element of the TORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA"
],
"length": 240,
"sequence": "MKYLENSSLEALSSSLSIGAIDCILDVKLESYSCKMVQSDKKQWKAYGGSNESSNVNDRQPLSPPDDFLSVSASPIGHSARMRHLSEAGHSGSETDADDFVLLDSISKRTLFDLIGALNIAYPDYDFSDVKSNCFSLIPGIEVVMEAVDSKFYATVNSYTSMRDELWLAIDNEIKPNECRIYSFKTNYKDDPFSEDGCLWCLNFFFHNKSLKRLMLLSCRALSQNGVTAYGDSLWDLDED",
"proteome": "UP000053676",
"gene": "NECAME_05199",
"go_terms": [
{
"identifier": "GO:0016480",
"name": "negative regulation of transcription by RNA polymerase III",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ba6bf6bac6beb12115815454bc348b426cd3435a",
"counters": {
"domain_architectures": 4252,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4252
}
}
}