General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W1QGK4",
        "id": "W1QGK4_OGAPD",
        "source_organism": {
            "taxId": "871575",
            "scientificName": "Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1)",
            "fullName": "Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1) (Yeast)"
        },
        "name": "H/ACA ribonucleoprotein complex subunit",
        "description": [
            "Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (\"psi\") residues may serve to stabilize the conformation of rRNAs"
        ],
        "length": 180,
        "sequence": "MNRGRGGFRGGRGGRSGPPVPQGPPDKVFEMGEFVHACEGDIVCKSINEKIPYFNAPIFLENKTQVGKVDEILGPLNEVFFTVKPSEGVQATSFKEGDKFYIAGDKLLPLERFLPKPKAVGPKPPRKKSSRGGAFAGRGGARGGSFRGGRGGARGSSRGGFSRGGSRGGRGSFRGRGRGF",
        "proteome": "UP000008673",
        "gene": "HPODL_01087",
        "go_terms": [
            {
                "identifier": "GO:0001522",
                "name": "pseudouridine synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042254",
                "name": "ribosome biogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ee64281510658e76b53b6adf410f200e6da51240",
        "counters": {
            "domain_architectures": 8956,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8956
        }
    }
}