General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "V9QFG7",
        "id": "TXA2_LATGE",
        "source_organism": {
            "taxId": "156851",
            "scientificName": "Latrodectus geometricus",
            "fullName": "Latrodectus geometricus (Brown widow spider)"
        },
        "name": "Alpha-latrotoxin associated low molecular weight protein 2",
        "description": [
            "May increase the toxicity of alpha-latrotoxin and/or other venom components. Is non-toxic to mice and to the cockroach Periplaneta americana"
        ],
        "length": 88,
        "sequence": "MLKLICIVFLVTVLTFVVGEDTLDPAEYGCPSDVDMAELTEKNEVCLRCEDFHKEGVAFTLCKTNCFTTEYYKNCVKDLEEAGKETEE",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "680bab4e258f2db99d7d9255b2adc4b988b07a96",
        "counters": {
            "domain_architectures": 1309,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1309
        }
    }
}