General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "V7BL54",
        "id": "V7BL54_PHAVU",
        "source_organism": {
            "taxId": "3885",
            "scientificName": "Phaseolus vulgaris",
            "fullName": "Phaseolus vulgaris (Kidney bean)"
        },
        "name": "Ribosome biogenesis protein NSA2 homolog",
        "description": [
            "Involved in the biogenesis of the 60S ribosomal subunit. May play a part in the quality control of pre-60S particles"
        ],
        "length": 260,
        "sequence": "MPQGDYIERHRRDYGYRLDHFERKRKKEARQVHKRSAIAQKALGIKGKMIAKKNYAEKAQMKKTLAMHEESTSRRKTDDNVQDGAVPAYLLDRDTTARAKVLSNTIKQKRKEKAGKWDVPLPKVRPVAEDEMFKVVRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTKAHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVMTKGTIIEVNVSELGLVTPAGKVVWGKYAQVTNNPENDGCINAVLLV",
        "proteome": "UP000000226",
        "gene": "PHAVU_007G268100g",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15743871b385ad83e47d1c45d5fe1037ac7640d3",
        "counters": {
            "domain_architectures": 13001,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 13001
        }
    }
}