General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "V6DJQ5",
        "id": "V6DJQ5_9LACO",
        "source_organism": {
            "taxId": "1273133",
            "scientificName": "Ligilactobacillus salivarius cp400",
            "fullName": "Ligilactobacillus salivarius cp400"
        },
        "name": "Nuclease SbcCD subunit D",
        "description": [
            "SbcCD cleaves DNA hairpin structures. These structures can inhibit DNA replication and are intermediates in certain DNA recombination reactions. The complex acts as a 3'->5' double strand exonuclease that can open hairpins. It also has a 5' single-strand endonuclease activity"
        ],
        "length": 371,
        "sequence": "MKFLHTADWHIGKKLHNFDLNYEEDDAFKQIERIAEEEKVDAIIIAGDLYDRSLPSEEAVKSVNEKLKRLNLVDKYPLLVISGNHDSATRLNTGSEWFKATNLFLNTKISGAFEPVEIEDTQFFLLPYFEPQEVRNYFDRQNLKNVQEAMQLIVEKIKEKFKPNMKHVLVAHFFAAGSTQTDSETNVMVGGLDAIPTSYLNDFDYVALGHLHDARASQAETIKYSGSPVKFSVSEATSQKGVWIVDTEKIAPKFVPLVPVHEINVLEDSFDNLISPSVYEKYSKEDYYAIRLTDTKVIPDVINKLRNYYPKILELRRVGEIQELKVEENKERDLTDPMKLVSDFFTEVTGEKLTSNQQKWVENALKDVNKK",
        "proteome": null,
        "gene": "sbcD",
        "go_terms": [
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004519",
                "name": "endonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008408",
                "name": "3'-5' exonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006259",
                "name": "DNA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5835761f2e582499f5033f08084c95f5bbcb023d",
        "counters": {
            "domain_architectures": 11996,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 11996
        }
    }
}