HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "V6DJQ5",
"id": "V6DJQ5_9LACO",
"source_organism": {
"taxId": "1273133",
"scientificName": "Ligilactobacillus salivarius cp400",
"fullName": "Ligilactobacillus salivarius cp400"
},
"name": "Nuclease SbcCD subunit D",
"description": [
"SbcCD cleaves DNA hairpin structures. These structures can inhibit DNA replication and are intermediates in certain DNA recombination reactions. The complex acts as a 3'->5' double strand exonuclease that can open hairpins. It also has a 5' single-strand endonuclease activity"
],
"length": 371,
"sequence": "MKFLHTADWHIGKKLHNFDLNYEEDDAFKQIERIAEEEKVDAIIIAGDLYDRSLPSEEAVKSVNEKLKRLNLVDKYPLLVISGNHDSATRLNTGSEWFKATNLFLNTKISGAFEPVEIEDTQFFLLPYFEPQEVRNYFDRQNLKNVQEAMQLIVEKIKEKFKPNMKHVLVAHFFAAGSTQTDSETNVMVGGLDAIPTSYLNDFDYVALGHLHDARASQAETIKYSGSPVKFSVSEATSQKGVWIVDTEKIAPKFVPLVPVHEINVLEDSFDNLISPSVYEKYSKEDYYAIRLTDTKVIPDVINKLRNYYPKILELRRVGEIQELKVEENKERDLTDPMKLVSDFFTEVTGEKLTSNQQKWVENALKDVNKK",
"proteome": null,
"gene": "sbcD",
"go_terms": [
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004519",
"name": "endonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008408",
"name": "3'-5' exonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006259",
"name": "DNA metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5835761f2e582499f5033f08084c95f5bbcb023d",
"counters": {
"domain_architectures": 11996,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 11996
}
}
}