General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "V5VGH4",
        "id": "V5VGH4_ACIBA",
        "source_organism": {
            "taxId": "470",
            "scientificName": "Acinetobacter baumannii",
            "fullName": "Acinetobacter baumannii"
        },
        "name": "proton-translocating NAD(P)(+) transhydrogenase",
        "description": [
            "The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane"
        ],
        "length": 104,
        "sequence": "MVETITIFVLAIFVGYYVVWGVTPALHTPLMAVTNALSSIIVVGAMLQTVGLPVLGVDANVAFQSVNVVSVLGAIAVFLASINIFGGFAVTARMLEMFKPKQKK",
        "proteome": null,
        "gene": "pntA",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0cfc2a622abdc6f3aeb6107a73a12ea7e394b2e6",
        "counters": {
            "domain_architectures": 7837,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7837
        }
    }
}