General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "V5AR19",
        "id": "V5AR19_TRYCR",
        "source_organism": {
            "taxId": "1416333",
            "scientificName": "Trypanosoma cruzi Dm28c",
            "fullName": "Trypanosoma cruzi Dm28c"
        },
        "name": "Presenilin",
        "description": [
            "Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors"
        ],
        "length": 318,
        "sequence": "MDEEAHDTIRGKIGSSIVNALILVAMLTVMTFLMVLLYACHCEKVLFAVLFFSAGFTLFYMTWMWMDLFCTRFQIPYDFITSSFLLWNAGIVGLVSIFYYAHPVLAQVYLVVVSVIVGWSMTFFSEWSTWSMLVFVALYDMVAVLSPRGPLKMLIQIAEKRNEPLPGFVYNSNANPSMQKAERVGVPPGEDMHTRDGSRENNSTDDADSKTSSQMTSVSRLYYALDRSPFKLGLGDFIFYSVLSARAALYAFMPWAASTVAVCFGLVATLTTLLMYKSRFPALPALPISICFGVAVFFLYRFVVTPLDYFAALSVLAL",
        "proteome": null,
        "gene": "TCDM_08999",
        "go_terms": [
            {
                "identifier": "GO:0042500",
                "name": "aspartic endopeptidase activity, intramembrane cleaving",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016485",
                "name": "protein processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c661181a01b211ed2d1c8b8b5e8a3bdf1b271f93",
        "counters": {
            "domain_architectures": 4227,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4227
        }
    }
}