GET /api/protein/UniProt/V4TXW5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "V4TXW5",
        "id": "V4TXW5_CITCL",
        "source_organism": {
            "taxId": "85681",
            "scientificName": "Citrus clementina",
            "fullName": "Citrus clementina (Clementine)"
        },
        "name": "Ubiquitin-related modifier 1 homolog",
        "description": [
            "Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates"
        ],
        "length": 99,
        "sequence": "MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG",
        "proteome": "UP000030687",
        "gene": "CICLE_v10023026mg",
        "go_terms": [
            {
                "identifier": "GO:0034227",
                "name": "tRNA thio-modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "536b2c79620b4cbf0f17daa338dbf26563b09d79",
        "counters": {
            "domain_architectures": 3875,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3875
        }
    }
}