GET /api/protein/UniProt/V2QGV9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "V2QGV9",
        "id": "V2QGV9_9BACT",
        "source_organism": {
            "taxId": "1379858",
            "scientificName": "Mucispirillum schaedleri ASF457",
            "fullName": "Mucispirillum schaedleri ASF457"
        },
        "name": "Flagellar assembly factor FliW",
        "description": [
            "Acts as an anti-CsrA protein, binds CsrA and prevents it from repressing translation of its target genes, one of which is flagellin. Binds to flagellin and participates in the assembly of the flagellum"
        ],
        "length": 159,
        "sequence": "MTNIVSKQDIKKDGSSRMKINSAKLGEIEYSEDDVITLSSPLLGFPDLQDFLIISDDNSYPFLWFQSVEDADICFILIETNTFFKDYNPDIPKRELKVIAISDKKEMKLFSIVVVPTDPKLSTANLRAPLVVNFEKKLAKQIILDDDAYKIKMPLFESE",
        "proteome": "UP000017429",
        "gene": "fliW",
        "go_terms": [
            {
                "identifier": "GO:0044780",
                "name": "bacterial-type flagellum assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6483b8055959ceab2543805fb1db9a6f4552cc1e",
        "counters": {
            "domain_architectures": 4301,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4301
        }
    }
}