GET /api/protein/UniProt/U7Q5A1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "U7Q5A1",
        "id": "U7Q5A1_SPOS1",
        "source_organism": {
            "taxId": "1391915",
            "scientificName": "Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183)",
            "fullName": "Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus)"
        },
        "name": "Mitochondrial thiamine pyrophosphate carrier 1",
        "description": [
            "Mitochondrial transporter that mediates uptake of thiamine pyrophosphate (ThPP) into mitochondria"
        ],
        "length": 332,
        "sequence": "MATDDLIKRKPVVGADILTQSRLFFSDPVVAAFCGGGVAGAVSRTVVSPLERLKILFQIQSVGRTEYQMPVGQALKKMWVEEGWRGFMRGNGTNCIRIVPYSAVQFGSYNFYKTHLFESYPGADLTSLARLTCGGIAGITSVVFTYPLDIVRTRLSIQTASFAGLGNRAAQMPGMWATLVLMYKNEGGFKALYRGIIPTVAGVAPYVGLNFMTYEAVRQYFTKDGEKNPTAVRKLAAGAISGAVAQTCTYPFDVLRRRFQINTMSGMGYQYKSLTDAIRVIVAQEGIRGLYKGIVPNLLKVTPSMASSWLSFEMSRDFLLGLRVEQDEEAVL",
        "proteome": "UP000018087",
        "gene": "HMPREF1624_00165",
        "go_terms": [
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
        "counters": {
            "domain_architectures": 140476,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 140476
        }
    }
}