GET /api/protein/UniProt/U6CTT7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "U6CTT7",
        "id": "U6CTT7_NEOVI",
        "source_organism": {
            "taxId": "452646",
            "scientificName": "Neovison vison",
            "fullName": "Neovison vison (American mink)"
        },
        "name": "Cyclin-dependent kinase 4 inhibitor C",
        "description": [
            "Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB"
        ],
        "length": 168,
        "sequence": "MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLPVVEFLMKHTASKVGHRNHKGDTACDLARLYRRNEVVSLMEGNQAEGASNLQ",
        "proteome": "UP000694425",
        "gene": "CDN2C",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c430d14e7e926ec094e930fccc32aca1e830dd07",
        "counters": {
            "domain_architectures": 5691,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "smart": 1,
                "profile": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5691
        }
    }
}