GET /api/protein/UniProt/U6BJB7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "U6BJB7",
        "id": "U6BJB7_9ENTO",
        "source_organism": {
            "taxId": "1219413",
            "scientificName": "rhinovirus C43",
            "fullName": "rhinovirus C43"
        },
        "name": "Genome polyprotein",
        "description": [
            "Component of immature procapsids, which is cleaved into capsid proteins VP4 and VP2 after maturation. Allows the capsid to remain inactive before the maturation step",
            "Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome",
            "Lies on the inner surface of the capsid shell. After binding to the host receptor, the capsid undergoes conformational changes. Capsid protein VP4 is released, Capsid protein VP1 N-terminus is externalized, and together, they shape a pore in the host membrane through which the viral genome is translocated into the host cell cytoplasm"
        ],
        "length": 143,
        "sequence": "MGAQVSKQSVGAHETTVHAGTGAVVKYFNINYYKDAASSGLTKQDFSQDPSKFTQPVADLLSNPALMSPSVEACGYSDRLKQITIGSSTITTQDAVNTIVAYGEWPSYLSDLDATSVDKPTHPETSSDRFYTLESVTGNGSSQ",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005198",
                "name": "structural molecule activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019028",
                "name": "viral capsid",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "a89f7c32717eee731c281b08de188bc31a642d69",
        "counters": {
            "domain_architectures": 7881,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7881
        }
    }
}