GET /api/protein/UniProt/U5WQM8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "U5WQM8",
        "id": "U5WQM8_MYCKA",
        "source_organism": {
            "taxId": "557599",
            "scientificName": "Mycobacterium kansasii ATCC 12478",
            "fullName": "Mycobacterium kansasii ATCC 12478"
        },
        "name": "Thioredoxin domain-containing protein",
        "description": [
            "Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides"
        ],
        "length": 220,
        "sequence": "MTLTIGSTAPDFEATTTDGPIKFHEWIGDSWAVLFSHPRDFTPVCTTELGYLATIKPEFDRRNVKIIGLSTDPLDSHAAWSKDIACTSGTAPNYPLIADTDYAVSKAYGMLPATIGGDPSDHPPAELATLRNVFVIDPNKTIMLVMIYPMTTGRNFDEVLRAIDSLQLLNNGLATPAQWRQGDDVIIAPWISDEQARHTYPDGWQGPLPYLRYVPSPQGL",
        "proteome": null,
        "gene": "MKAN_15545",
        "go_terms": [
            {
                "identifier": "GO:0016209",
                "name": "antioxidant activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051920",
                "name": "peroxiredoxin activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0098869",
                "name": "cellular oxidant detoxification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9db26b9b236ea914ef8a2d52a7760b3ae17fb31b",
        "counters": {
            "domain_architectures": 37286,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 1,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 37286
        }
    }
}