GET /api/protein/UniProt/U5II37/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "U5II37",
        "id": "U5II37_9MYRT",
        "source_organism": {
            "taxId": "507396",
            "scientificName": "Combretum celastroides subsp. orientale",
            "fullName": "Combretum celastroides subsp. orientale"
        },
        "name": "Maturase K",
        "description": [
            "Usually encoded in the trnK tRNA gene intron. Probably assists in splicing its own and other chloroplast group II introns"
        ],
        "length": 235,
        "sequence": "SSLHLLRFFLYDYWNSLITPNKHISILSKGNPRLFLFLYNSHICEYESIVLFLRNHSSHLRSTSYGVFFERIFFYGKIEHLVKVFFDNDFQHILWGFKNPFLQYLRYQGKSILASKDTPLMSNKWKYYLINLWQYYFYVRSQPGRIHINQLCKYSLDFLGYLSRVRINSLVVRSQILENSFLIDNAMKKFETIVPIMPLIGSLFKAKFCNAFGHPISKPTRADSSDSDIIDQFVR",
        "proteome": null,
        "gene": "matK",
        "go_terms": [
            {
                "identifier": "GO:0006397",
                "name": "mRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009507",
                "name": "chloroplast",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b7992d7d95a8fe2c1f9f11eec3ebf0dd2bb6af02",
        "counters": {
            "domain_architectures": 123651,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 123651
        }
    }
}