GET /api/protein/UniProt/U5II37/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "U5II37",
"id": "U5II37_9MYRT",
"source_organism": {
"taxId": "507396",
"scientificName": "Combretum celastroides subsp. orientale",
"fullName": "Combretum celastroides subsp. orientale"
},
"name": "Maturase K",
"description": [
"Usually encoded in the trnK tRNA gene intron. Probably assists in splicing its own and other chloroplast group II introns"
],
"length": 235,
"sequence": "SSLHLLRFFLYDYWNSLITPNKHISILSKGNPRLFLFLYNSHICEYESIVLFLRNHSSHLRSTSYGVFFERIFFYGKIEHLVKVFFDNDFQHILWGFKNPFLQYLRYQGKSILASKDTPLMSNKWKYYLINLWQYYFYVRSQPGRIHINQLCKYSLDFLGYLSRVRINSLVVRSQILENSFLIDNAMKKFETIVPIMPLIGSLFKAKFCNAFGHPISKPTRADSSDSDIIDQFVR",
"proteome": null,
"gene": "matK",
"go_terms": [
{
"identifier": "GO:0006397",
"name": "mRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009507",
"name": "chloroplast",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b7992d7d95a8fe2c1f9f11eec3ebf0dd2bb6af02",
"counters": {
"domain_architectures": 123651,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 123651
}
}
}