GET /api/protein/UniProt/U3R6S5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "U3R6S5",
        "id": "U3R6S5_9ASTE",
        "source_organism": {
            "taxId": "2607137",
            "scientificName": "Ipomoea macalusoi",
            "fullName": "Ipomoea macalusoi"
        },
        "name": "ATP-dependent Clp protease proteolytic subunit",
        "description": [
            "Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins"
        ],
        "length": 205,
        "sequence": "MPIGVPKVPFRNPGDEDASWVDIYNRLYRERFLFLVQEIDSEIANQIVGLLVYLNIEDGTKDIFLYINSPGGDVISGVAIYDMMQTVRPDVNTVCIGLAASMGSFILAGGAITRRAAFPHARVMIHQPRTSFFESHAGELLLEMKEALKLRERIAEIYAQRTGNPTSIISQDMDRDVFFSARQARIYGIIDDIEFSDDDEEFLRG",
        "proteome": null,
        "gene": "clpP",
        "go_terms": [
            {
                "identifier": "GO:0004176",
                "name": "ATP-dependent peptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004252",
                "name": "serine-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8b36e1ef7ed4f1caec784c71a0c390b681925f43",
        "counters": {
            "domain_architectures": 75281,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 75281
        }
    }
}