General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "U3KDU7",
        "id": "U3KDU7_FICAL",
        "source_organism": {
            "taxId": "59894",
            "scientificName": "Ficedula albicollis",
            "fullName": "Ficedula albicollis (Collared flycatcher)"
        },
        "name": "Osteoclast-stimulating factor 1",
        "description": [
            "Induces bone resorption, acting probably through a signaling cascade which results in the secretion of factor(s) enhancing osteoclast formation and activity"
        ],
        "length": 219,
        "sequence": "MSKPPPKPAKPGQVKVFRALYTFEPRTPDELYFEEGDIIYISDMSDTNWWKGTCKGRTGLIPSNYVAEQAESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGNTALYWACHGGHKDVVDVLLTQANLELNQQNKLGDTALHAAAWKGYADIVEMLLEKGARTDLKNNEKKLALDMATNAACASLLKKKQSAVQQLHRQRTSEKRGNQEEPRGDGN",
        "proteome": "UP000016665",
        "gene": "OSTF1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a2ae1f990a89684ee073967ccb1804a0ac637e05",
        "counters": {
            "domain_architectures": 585,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 3,
                "smart": 2,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "prints": 3,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 585
        }
    }
}