GET /api/protein/UniProt/U3KDU7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "U3KDU7",
"id": "U3KDU7_FICAL",
"source_organism": {
"taxId": "59894",
"scientificName": "Ficedula albicollis",
"fullName": "Ficedula albicollis (Collared flycatcher)"
},
"name": "Osteoclast-stimulating factor 1",
"description": [
"Induces bone resorption, acting probably through a signaling cascade which results in the secretion of factor(s) enhancing osteoclast formation and activity"
],
"length": 219,
"sequence": "MSKPPPKPAKPGQVKVFRALYTFEPRTPDELYFEEGDIIYISDMSDTNWWKGTCKGRTGLIPSNYVAEQAESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGNTALYWACHGGHKDVVDVLLTQANLELNQQNKLGDTALHAAAWKGYADIVEMLLEKGARTDLKNNEKKLALDMATNAACASLLKKKQSAVQQLHRQRTSEKRGNQEEPRGDGN",
"proteome": "UP000016665",
"gene": "OSTF1",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a2ae1f990a89684ee073967ccb1804a0ac637e05",
"counters": {
"domain_architectures": 585,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"profile": 3,
"smart": 2,
"cdd": 1,
"pfam": 2,
"panther": 1,
"prints": 3,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 585
}
}
}