GET /api/protein/UniProt/T1ZFH5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "T1ZFH5",
        "id": "T1ZFH5_STRIT",
        "source_organism": {
            "taxId": "862967",
            "scientificName": "Streptococcus intermedius B196",
            "fullName": "Streptococcus intermedius B196"
        },
        "name": "Permease IIC component",
        "description": [
            "The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane"
        ],
        "length": 433,
        "sequence": "MAKVDTQKIIAPIMKFVNMRGIIALKDGMLAILPLTVVGSIFLIVGQLPFEGLNQAIADIFGKNWTEPFMQVYSGTFAIMGLISCFSIGYSYAKNSGVEPLPAGVLSVSSFFILLKSSYVPTKGEPIADAITKVWFGGQGIIGAIIIGLVVGSIYTMFIQKHIVIKMPEQVPQAIAKQFEAMIPAFVIFFLSMVVYILAKMLTKGGTFIEMIYGVIQVPLQGLTGSLYGAIGIAFFISFLWWFGVHGQSVVNGVVTALLLSNLDANKALLAAGKLSVGKGAHIVTQQFLDSFLILSGSGITFGLVVAMIFAAKSKQYKALGKVAAFPAIFNVNEPVVFGFPIVMNPVMFLPFILVPVLAAVIVYGSIAIGFMQPFSGVTLPWSTPAIISGFLVAGWQGALIQVVILAMSTLIYFPFFKFQDNLAYSNELKAEG",
        "proteome": "UP000016233",
        "gene": "SIR_1080",
        "go_terms": [
            {
                "identifier": "GO:0008982",
                "name": "protein-N(PI)-phosphohistidine-sugar phosphotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009401",
                "name": "phosphoenolpyruvate-dependent sugar phosphotransferase system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e44151878caabaa92bbd0ce5cc1197c17863da6b",
        "counters": {
            "domain_architectures": 21575,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21575
        }
    }
}