GET /api/protein/UniProt/T1QLT1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "T1QLT1",
        "id": "T1QLT1_EUCDE",
        "source_organism": {
            "taxId": "106642",
            "scientificName": "Eucalyptus deglupta",
            "fullName": "Eucalyptus deglupta (Mindanao gum)"
        },
        "name": "NAD(P)H-quinone oxidoreductase subunit J, chloroplastic",
        "description": [
            "NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient",
            "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
        ],
        "length": 158,
        "sequence": "MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRRNPRIPSVFWIWKSADFQERESYDMLGICYDTHPRLKRILMPETWIGWPLRKDYIAPNFYEIQDAH",
        "proteome": null,
        "gene": "ndhJ",
        "go_terms": [
            {
                "identifier": "GO:0008137",
                "name": "NADH dehydrogenase (ubiquinone) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016651",
                "name": "oxidoreductase activity, acting on NAD(P)H",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a773b7c7baaff38b6179f5153d2849f261faa1a6",
        "counters": {
            "domain_architectures": 35959,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 35959
        }
    }
}