GET /api/protein/UniProt/T1KWK4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "T1KWK4",
"id": "T1KWK4_TETUR",
"source_organism": {
"taxId": "32264",
"scientificName": "Tetranychus urticae",
"fullName": "Tetranychus urticae (Two-spotted spider mite)"
},
"name": "DnaJ homolog subfamily B member 9",
"description": [
"Co-chaperone for Hsp70 protein HSPA5/BiP that acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response (UPR). J domain-containing co-chaperones stimulate the ATPase activity of Hsp70 proteins and are required for efficient substrate recognition by Hsp70 proteins. In the unstressed endoplasmic reticulum, interacts with the luminal region of ERN1/IRE1 and selectively recruits HSPA5/BiP: HSPA5/BiP disrupts the dimerization of the active ERN1/IRE1 luminal region, thereby inactivating ERN1/IRE1. Also involved in endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins. Required for survival of B-cell progenitors and normal antibody production"
],
"length": 120,
"sequence": "MSKDCYKILGISEDASVGEIKKAYRELALKYHPDKNQDANAKVKFQQVSYAYKTLMDEKSRDMPQAMQTDCDLDSDIKDFLILAGITLAGVSALYCVLQGQSGGYEDETEKDKEHQSGKE",
"proteome": "UP000015104",
"gene": "107367893",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "500088c3adc88e8af670fe08554083396acf46f3",
"counters": {
"domain_architectures": 98256,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 98256
}
}
}