General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "T1KWK4",
        "id": "T1KWK4_TETUR",
        "source_organism": {
            "taxId": "32264",
            "scientificName": "Tetranychus urticae",
            "fullName": "Tetranychus urticae (Two-spotted spider mite)"
        },
        "name": "DnaJ homolog subfamily B member 9",
        "description": [
            "Co-chaperone for Hsp70 protein HSPA5/BiP that acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response (UPR). J domain-containing co-chaperones stimulate the ATPase activity of Hsp70 proteins and are required for efficient substrate recognition by Hsp70 proteins. In the unstressed endoplasmic reticulum, interacts with the luminal region of ERN1/IRE1 and selectively recruits HSPA5/BiP: HSPA5/BiP disrupts the dimerization of the active ERN1/IRE1 luminal region, thereby inactivating ERN1/IRE1. Also involved in endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins. Required for survival of B-cell progenitors and normal antibody production"
        ],
        "length": 120,
        "sequence": "MSKDCYKILGISEDASVGEIKKAYRELALKYHPDKNQDANAKVKFQQVSYAYKTLMDEKSRDMPQAMQTDCDLDSDIKDFLILAGITLAGVSALYCVLQGQSGGYEDETEKDKEHQSGKE",
        "proteome": "UP000015104",
        "gene": "107367893",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "500088c3adc88e8af670fe08554083396acf46f3",
        "counters": {
            "domain_architectures": 98256,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 98256
        }
    }
}