GET /api/protein/UniProt/T1KJY6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "T1KJY6",
"id": "T1KJY6_TETUR",
"source_organism": {
"taxId": "32264",
"scientificName": "Tetranychus urticae",
"fullName": "Tetranychus urticae (Two-spotted spider mite)"
},
"name": "Methyltransferase domain-containing protein",
"description": [
"Mitochondrial ribosome (mitoribosome) assembly factor. Binds at the interface of the head and body domains of the mitochondrial small ribosomal subunit (mt-SSU), occluding the mRNA channel and preventing compaction of the head domain towards the body. Probable inactive methyltransferase: retains the characteristic folding and ability to bind S-adenosyl-L-methionine, but it probably lost its methyltransferase activity"
],
"length": 538,
"sequence": "MSLINYPIQDIHVRVDLDANSDQVGLAARSCVDENCTGERGDKDVNLERARLFDEHVLSSFNYFTDNLFSVYTSQSIRQVTTTVNKVELHADIDEKLTQGLRARAQPGRRALPTVDLPVTLESACYKVISKYKRPAFKDDVFRVHNQFHHRQLPSEPAEIQQKYKEIEYRYVQKENFVLSELDPISREEELRKREEKIQATLKKEIYNWQPVEYDEYNSIVYMAARLAPNFAATKFVLHDIKCTYPDFKPKTLFDFGSGVGTTIWAANEIWPKSFSEYFCVDISKEAHDIARLLLKQGDDTKPLIYEGIFTRQFLPVASDIKYDLVVSAFSLLELPSLRSRVNTIENLWHKTDDLLVIIEHGKKAGFAAVLEARNLVLQITGHKVTDTFNVDSEIRGVTESDDNQVPSSHIIGPCPHNYPCPKLFTGQIEPCNFSVSFNHLQYGELSKILWGNREEFSYCVIQKKPRNFKENPPWPRVISPVIRKQASALCKLCCPDGTIKNIRVGKQRDTKNLYNLVKLSKWSDLLPVTIHQVEKLD",
"proteome": "UP000015104",
"gene": null,
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6ff58c42861c1eddbdb59fd9dc0cbb5a00b469dd",
"counters": {
"domain_architectures": 4531,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4531
}
}
}