General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "T1KJY6",
        "id": "T1KJY6_TETUR",
        "source_organism": {
            "taxId": "32264",
            "scientificName": "Tetranychus urticae",
            "fullName": "Tetranychus urticae (Two-spotted spider mite)"
        },
        "name": "Methyltransferase domain-containing protein",
        "description": [
            "Mitochondrial ribosome (mitoribosome) assembly factor. Binds at the interface of the head and body domains of the mitochondrial small ribosomal subunit (mt-SSU), occluding the mRNA channel and preventing compaction of the head domain towards the body. Probable inactive methyltransferase: retains the characteristic folding and ability to bind S-adenosyl-L-methionine, but it probably lost its methyltransferase activity"
        ],
        "length": 538,
        "sequence": "MSLINYPIQDIHVRVDLDANSDQVGLAARSCVDENCTGERGDKDVNLERARLFDEHVLSSFNYFTDNLFSVYTSQSIRQVTTTVNKVELHADIDEKLTQGLRARAQPGRRALPTVDLPVTLESACYKVISKYKRPAFKDDVFRVHNQFHHRQLPSEPAEIQQKYKEIEYRYVQKENFVLSELDPISREEELRKREEKIQATLKKEIYNWQPVEYDEYNSIVYMAARLAPNFAATKFVLHDIKCTYPDFKPKTLFDFGSGVGTTIWAANEIWPKSFSEYFCVDISKEAHDIARLLLKQGDDTKPLIYEGIFTRQFLPVASDIKYDLVVSAFSLLELPSLRSRVNTIENLWHKTDDLLVIIEHGKKAGFAAVLEARNLVLQITGHKVTDTFNVDSEIRGVTESDDNQVPSSHIIGPCPHNYPCPKLFTGQIEPCNFSVSFNHLQYGELSKILWGNREEFSYCVIQKKPRNFKENPPWPRVISPVIRKQASALCKLCCPDGTIKNIRVGKQRDTKNLYNLVKLSKWSDLLPVTIHQVEKLD",
        "proteome": "UP000015104",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6ff58c42861c1eddbdb59fd9dc0cbb5a00b469dd",
        "counters": {
            "domain_architectures": 4531,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4531
        }
    }
}