General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "S9XA11",
        "id": "S9XA11_SCHCR",
        "source_organism": {
            "taxId": "653667",
            "scientificName": "Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691)",
            "fullName": "Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) (Fission yeast)"
        },
        "name": "Non-structural maintenance of chromosomes element 1 homolog",
        "description": [
            "Acts in a DNA repair pathway for removal of UV-induced DNA damage that is distinct from classical nucleotide excision repair and in repair of ionizing radiation damage. Functions in homologous recombination repair of DNA double strand breaks and in recovery of stalled replication forks"
        ],
        "length": 234,
        "sequence": "MEGDTRIEENAEKQKFVLQYVMNRTFGVDEDVVQGLIHDLFGESASLSQTMNEINKNIHNYDFKLQKIQDQLDGRPTWHFQNLSGDPVSQMATPYSTNQIELMRRIIDWIMQADEYQYSITTLQIHKYARRDMSLAPSIIENYLSTFERDGWLNQREGIWTFTNHALADMEAYLHNEYESSLYECNACRGIVTAGYVCECGYCLHVYCCKHLAYESCPNCSTNWTEATTIGRWY",
        "proteome": "UP000015464",
        "gene": "SPOG_00862",
        "go_terms": [
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030915",
                "name": "Smc5-Smc6 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "01b610901a51841cfd763bba3cb5fade0f8d717e",
        "counters": {
            "domain_architectures": 705,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 705
        }
    }
}