General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "S9X5U4",
        "id": "S9X5U4_SCHCR",
        "source_organism": {
            "taxId": "653667",
            "scientificName": "Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691)",
            "fullName": "Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) (Fission yeast)"
        },
        "name": "Deoxyuridine 5'-triphosphate nucleotidohydrolase",
        "description": [
            "Involved in nucleotide metabolism via production of dUMP, the immediate precursor of thymidine nucleotides, and decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA",
            "This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA"
        ],
        "length": 145,
        "sequence": "MSFFVQKLSDKATVPTKGSALAAGYDLYAAAECTIPAHGKALVDTDLSIAVPQDTYGRIAPRSGLAAKYFIDVGAGVVDADYRGHVRVLLFNHGDSDFPVKVGDRVAQIILEKIATPPVILVENLEATVRGTGGFGSTGVHKHQE",
        "proteome": "UP000015464",
        "gene": "SPOG_01776",
        "go_terms": [
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004170",
                "name": "dUTP diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006226",
                "name": "dUMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046081",
                "name": "dUTP catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5adb127e6bef47e972ed9845ea1b8804ddd1e9d6",
        "counters": {
            "domain_architectures": 30613,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30613
        }
    }
}