HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "S9V1P6",
"id": "S9V1P6_9TRYP",
"source_organism": {
"taxId": "28005",
"scientificName": "Strigomonas culicis",
"fullName": "Strigomonas culicis"
},
"name": "ADP/ATP translocase",
"description": [
"ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane",
"Catalyzes the exchange of ADP and ATP across the membrane"
],
"length": 322,
"sequence": "MSDAKSAAPVEGKKVSREKLPKLGFWEEFMISGVAAGVAKTAAAPIERVKLLVQNQGEMIKQGTLDRPYTGVLDCLTRTMKTEGVYALWRGNLSNVLRYFPTQALNFAFKDQFKRLFNYKKDKDGYLKWFMGNMASGGLAGAVSLCFVYSLDYVRTRLANDTKSSKKGGARQYSGMIDCYVKTFKSDGLTGLYRGFCVSCVGIIAYRGFYFGLYDTLQPMLPVDTFIVNFMLGWVVTIVSGLISYPLDTVRRRMMMTSGTGKNYSSSFQCMTSVIKEEGAMSLMRGAGANILRGVAGALVLSGVDAIKPQYVKYRAGLKKAE",
"proteome": "UP000015354",
"gene": "STCU_00296",
"go_terms": [
{
"identifier": "GO:0005471",
"name": "ATP:ADP antiporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0140021",
"name": "mitochondrial ADP transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:1990544",
"name": "mitochondrial ATP transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005743",
"name": "mitochondrial inner membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 140476,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"profile": 1,
"cathgene3d": 1,
"panther": 1,
"prints": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140476
}
}
}