GET /api/protein/UniProt/S5NN28/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "S5NN28",
"id": "S5NN28_SALBN",
"source_organism": {
"taxId": "1197719",
"scientificName": "Salmonella bongori N268-08",
"fullName": "Salmonella bongori N268-08"
},
"name": "Anaerobic ribonucleoside-triphosphate reductase-activating protein",
"description": [
"Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine"
],
"length": 128,
"sequence": "MHECPGCYNKSTWRLNSGQPFTKEMEDKIIADLNDTRIHRQGISLSGGDPLHPQNVPDILKLVQRIRAECPGKDIWVWTGYKLDELNAAQMQVVDLINVLVDGKFVQALKDPALIWRGSSNQVVHHLR",
"proteome": null,
"gene": "A464_4440",
"go_terms": [
{
"identifier": "GO:0043365",
"name": "[formate-C-acetyltransferase]-activating enzyme activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f4eb6e88a19b6656848688f05b40f67370b920d2",
"counters": {
"domain_architectures": 12735,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"ncbifam": 2,
"panther": 1,
"pirsf": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 12735
}
}
}