GET /api/protein/UniProt/S5G1L7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "S5G1L7",
"id": "S5G1L7_9PSIT",
"source_organism": {
"taxId": "1358780",
"scientificName": "Rhynchopsitta terrisi",
"fullName": "Rhynchopsitta terrisi (maroon-fronted parrot)"
},
"name": "NADH-ubiquinone oxidoreductase chain 6",
"description": [
"Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone",
"Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I"
],
"length": 170,
"sequence": "MMYFLAFLGVSFVLASLLVASNPSPHYGVVGLVFGSVVGCGWLVSLGASFVSLVLFMVYLGGMLVVFVYSVSLAADPFPQAWGGRYVVGYALGLVPIGVGLAVWGWGGGFKMDTVDSVGGVFVRLDFSGVALFYSCGGGMFLVGGWGLLLTLFVVLEVVRGLSRGVIRAV",
"proteome": null,
"gene": "ND6",
"go_terms": [
{
"identifier": "GO:0008137",
"name": "NADH dehydrogenase (ubiquinone) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "96cfd4c69773af29d548fde0c6c747d9cca5615a",
"counters": {
"domain_architectures": 51372,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 51372
}
}
}