General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "S4R712",
        "id": "S4R712_PETMA",
        "source_organism": {
            "taxId": "7757",
            "scientificName": "Petromyzon marinus",
            "fullName": "Petromyzon marinus (Sea lamprey)"
        },
        "name": "Centrosomal protein 20",
        "description": [
            "Involved in the biogenesis of cilia. Required for the recruitment of PLK1 to centrosomes and S phase progression"
        ],
        "length": 170,
        "sequence": "PIVFALPAVRESLERRGVLAATRARLRAEVFTSLAEPETARPPLPHENLLLNELIHEYLSYNQYNYTAGVLVTEAGQPDTRLERDFLARELHVLEEPSARSVPLLYGMLAHFMSRGAGVNASQSVPMPGGSRGLQRAPSPSRVPQKIATAGDTGVEEPAMTQFVVRGGYR",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0034453",
                "name": "microtubule anchoring",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005815",
                "name": "microtubule organizing center",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c394b4ca8abcd2373274dac20c2ab7d857b3ea58",
        "counters": {
            "domain_architectures": 3338,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3338
        }
    }
}