GET /api/protein/UniProt/S4PMR9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "S4PMR9",
"id": "S4PMR9_9NEOP",
"source_organism": {
"taxId": "116150",
"scientificName": "Pararge aegeria",
"fullName": "Pararge aegeria (speckled wood butterfly)"
},
"name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial",
"description": [
"Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
],
"length": 190,
"sequence": "MVSWSALGRSFGTNLFKNNIKAPFVVQNVNFSVGKKLASDHGHRTMALQPSRWQWHKFKDMFHYYLMMGLIPVGAIIFYTNVFIGPAQLTPIPDDYHPKHWEYHRHPITRFIARYIHNSPQQEYEKFLHFIDEEAQRQKLRALEKEVTRKMAERNDYQAYYYRPMVNKYLRINKKAGDDIMERVGDDYKD",
"proteome": null,
"gene": null,
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "76403b4fe60ff5d5267a2a2bbf7b2f37f785b8bc",
"counters": {
"domain_architectures": 1670,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1670
}
}
}