GET /api/protein/UniProt/S4PDP5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "S4PDP5",
"id": "S4PDP5_9NEOP",
"source_organism": {
"taxId": "116150",
"scientificName": "Pararge aegeria",
"fullName": "Pararge aegeria (speckled wood butterfly)"
},
"name": "Pyruvate dehydrogenase E1 component subunit beta",
"description": [
"The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2"
],
"length": 366,
"sequence": "MALKSPPVLFGLLGRLSRRSFSTSKALSSKPVTVRDALNQAIDEEMEKDDKVFVLGEEVAQYDGAYKVTRGLWKKYGDKRVIDTPITEIGFAGIAVGAAFAGLKPICEFMTFNFSMQAIDHMINSAAKTYYMSAGAIPVSIVFRGPNGAAAGVAAQHSQCFGAWFSHCPGFKVLMPYSSEDAKGLLKAAIRDRDPVVFLEDEILYGVPFPMSDEALSSDFVLPIGKAKIERPGNHITVVCAGRATDTALQAANELAGKGIECEVINLRSIRPLDFDTIAQSIAKTHHLITVEQGWPQSGIGAEICARVMESAAFFELDAPVWRVAGADVPMPYARSLEALALPRAPDVVAAATAVLANKISESMNQ",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0004739",
"name": "pyruvate dehydrogenase (acetyl-transferring) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006086",
"name": "pyruvate decarboxylation to acetyl-CoA",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4347a88d8b8d5a4cc8b0ce107fb03375ff211f8d",
"counters": {
"domain_architectures": 52316,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"ssf": 2,
"cathgene3d": 2,
"smart": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 2,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 52316
}
}
}