General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "S4PDP5",
        "id": "S4PDP5_9NEOP",
        "source_organism": {
            "taxId": "116150",
            "scientificName": "Pararge aegeria",
            "fullName": "Pararge aegeria (speckled wood butterfly)"
        },
        "name": "Pyruvate dehydrogenase E1 component subunit beta",
        "description": [
            "The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2"
        ],
        "length": 366,
        "sequence": "MALKSPPVLFGLLGRLSRRSFSTSKALSSKPVTVRDALNQAIDEEMEKDDKVFVLGEEVAQYDGAYKVTRGLWKKYGDKRVIDTPITEIGFAGIAVGAAFAGLKPICEFMTFNFSMQAIDHMINSAAKTYYMSAGAIPVSIVFRGPNGAAAGVAAQHSQCFGAWFSHCPGFKVLMPYSSEDAKGLLKAAIRDRDPVVFLEDEILYGVPFPMSDEALSSDFVLPIGKAKIERPGNHITVVCAGRATDTALQAANELAGKGIECEVINLRSIRPLDFDTIAQSIAKTHHLITVEQGWPQSGIGAEICARVMESAAFFELDAPVWRVAGADVPMPYARSLEALALPRAPDVVAAATAVLANKISESMNQ",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004739",
                "name": "pyruvate dehydrogenase (acetyl-transferring) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006086",
                "name": "pyruvate decarboxylation to acetyl-CoA",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4347a88d8b8d5a4cc8b0ce107fb03375ff211f8d",
        "counters": {
            "domain_architectures": 52316,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 2,
                "cathgene3d": 2,
                "smart": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 52316
        }
    }
}