GET /api/protein/UniProt/R9ZSZ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "R9ZSZ5",
"id": "R9ZSZ5_GLYCA",
"source_organism": {
"taxId": "48924",
"scientificName": "Glycine canescens",
"fullName": "Glycine canescens (Silky glycine)"
},
"name": "NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic",
"description": [
"NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient"
],
"length": 363,
"sequence": "MIIYLTEIQDIHFFFKLEYFKEIYGIIWVFAPILILILGITISVLAIVWLEREISAGIQQRIGPEYTGPFGVLQALADGTKLLFKENLIPSRGDIRLFSIGPSISVISIIISYSVIPFGYNFVLSDLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVLSISLLSNSLSTVDIVDAQSKYGFWGWNLWRQPMGFIVFLISSLAECERLPFDLPEAEEELVAGYQTEYSGIKFGLFYVASYLNLFISSLFVTVLYLGGSNISIPYIFVSDFFEINQTYGVFVTIIGIFITLAKTYLFLFLSIATRWTLPRLRIDQLLNLGWKFLLPISLGNLLLTTSSQLFSL",
"proteome": null,
"gene": "ndhA",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "864b30094953a8b5e4deba394bc1ff33053fe7c1",
"counters": {
"domain_architectures": 93545,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"pfam": 1,
"prosite": 2,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 93545
}
}
}