GET /api/protein/UniProt/R9YZI1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "R9YZI1",
"id": "R9YZI1_PLABR",
"source_organism": {
"taxId": "5824",
"scientificName": "Plasmodium brasilianum",
"fullName": "Plasmodium brasilianum"
},
"name": "Circumsporozoite protein",
"description": [
"Essential sporozoite protein. In the mosquito vector, required for sporozoite development in the oocyst, migration through the vector hemolymph and entry into the vector salivary glands. In the vertebrate host, required for sporozoite migration through the host dermis and infection of host hepatocytes. Binds to highly sulfated heparan sulfate proteoglycans (HSPGs) on the surface of host hepatocytes",
"[Circumsporozoite protein C-terminus]: In the vertebrate host, binds to highly sulfated heparan sulfate proteoglycans (HSPGs) on the surface of host hepatocytes and is required for sporozoite invasion of the host hepatocytes"
],
"length": 344,
"sequence": "KKLSVLAISSFLIVDFLFPGYHHNSNSTKSRNLSELCYNNVDTKLFNELEVRYSTNQDHFYNYNKTIRLLNENNNEKDGNVTNERKKKPTKAVENKLKQPPGDDDGAGNDEGNDAGNDAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNEKAKNKDNKVDANTNKKDNQEENNDSSDGPSEEHIKNYLESIRNSITEEWSPCSVTCGSGIRARRKVDAKNKKPAELVLSDLETEICSLDKCSSIFNVVSNSLGIVLVLVLILFH",
"proteome": null,
"gene": "CSP",
"go_terms": [
{
"identifier": "GO:0009986",
"name": "cell surface",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b09d8931e1163c497f26c9d79b98b41be6b8bbcd",
"counters": {
"domain_architectures": 5484,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"ssf": 1,
"pfam": 1,
"prints": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 5484
}
}
}