HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "R9RNF8",
"id": "R9RNF8_9TELE",
"source_organism": {
"taxId": "206128",
"scientificName": "Lagocephalus laevigatus",
"fullName": "Lagocephalus laevigatus (smooth puffer)"
},
"name": "Rhodopsin",
"description": [
"Photoreceptor required for image-forming vision at low light intensity. While most salt water fish species use retinal as chromophore, most freshwater fish use 3-dehydroretinal, or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin and terminates signaling"
],
"length": 276,
"sequence": "QYYLVNPAAYAALGAYMFLLILLGFPINFLTLYVTLEHKKLRTPLNYILLNLAVANLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWVVVCKPISNFRFGENHAIMGLAFTWFMASACAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFICHFLTPLIVVFFCYGRLLCAVKEAAAAQQESETTQRAEREVTRMVVIMVIAFLVCWLPYASVAWWIFTHQGSEFGPVFMTIPAFFAKSSSIYNP",
"proteome": null,
"gene": "Rhod",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004930",
"name": "G protein-coupled receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007186",
"name": "G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007601",
"name": "visual perception",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007602",
"name": "phototransduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
"counters": {
"domain_architectures": 394800,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"prints": 3,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 394800
}
}
}