GET /api/protein/UniProt/R9RNF8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "R9RNF8",
        "id": "R9RNF8_9TELE",
        "source_organism": {
            "taxId": "206128",
            "scientificName": "Lagocephalus laevigatus",
            "fullName": "Lagocephalus laevigatus (smooth puffer)"
        },
        "name": "Rhodopsin",
        "description": [
            "Photoreceptor required for image-forming vision at low light intensity. While most salt water fish species use retinal as chromophore, most freshwater fish use 3-dehydroretinal, or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin and terminates signaling"
        ],
        "length": 276,
        "sequence": "QYYLVNPAAYAALGAYMFLLILLGFPINFLTLYVTLEHKKLRTPLNYILLNLAVANLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWVVVCKPISNFRFGENHAIMGLAFTWFMASACAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFICHFLTPLIVVFFCYGRLLCAVKEAAAAQQESETTQRAEREVTRMVVIMVIAFLVCWLPYASVAWWIFTHQGSEFGPVFMTIPAFFAKSSSIYNP",
        "proteome": null,
        "gene": "Rhod",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004930",
                "name": "G protein-coupled receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007186",
                "name": "G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0007601",
                "name": "visual perception",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0007602",
                "name": "phototransduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
        "counters": {
            "domain_architectures": 394800,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 3,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 394800
        }
    }
}