GET /api/protein/UniProt/R9APZ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "R9APZ5",
        "id": "R9APZ5_9GAMM",
        "source_organism": {
            "taxId": "1120927",
            "scientificName": "Acinetobacter tandoii DSM 14970 = CIP 107469",
            "fullName": "Acinetobacter tandoii DSM 14970 = CIP 107469"
        },
        "name": "Small ribosomal subunit protein uS15",
        "description": [
            "One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA",
            "Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome"
        ],
        "length": 89,
        "sequence": "MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKEHKHDHHSRRGLIRMVNQRRKLLDYLNGKDHGRYVALIGALGLRR",
        "proteome": "UP000016201",
        "gene": "rpsO",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "48f0ea65cf3b6efab19db184f17ebd349a6b87aa",
        "counters": {
            "domain_architectures": 41585,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 41585
        }
    }
}